PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0730s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family EIL
Protein Properties Length: 550aa    MW: 62092.7 Da    PI: 5.8409
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0730s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3468.16e-143414111353
                          XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                 EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasds 90 
                          +el++rmw+d+m++krl+er+k+    ke + g+kk+++s+eqarrkkmsraQDgiLkYMlk+mevcnaqGfvYgiipe+gkpv+gasd+
  Kalax.0730s0010.1.p  41 DELERRMWRDKMRIKRLRERQKS----KEGDDGSKKQQQSEEQARRKKMSRAQDGILKYMLKMMEVCNAQGFVYGIIPENGKPVTGASDN 126
                          79*******************98....66667899******************************************************* PP

                          XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HH CS
                 EIN3  91 LraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelw 180
                          Lr+WWk+ v+fd ngpaai ky ++n i++ + s  +    + ++l+elqDTtlgSLLsalmqhcdppqrrfple+gv+pPWWPtG+e+w
  Kalax.0730s0010.1.p 127 LREWWKDRVRFDHNGPAAILKYMKDNSIPNPNGSH-MLVGPTTSTLQELQDTTLGSLLSALMQHCDPPQRRFPLERGVAPPWWPTGTEDW 215
                          ****************************9977777.5599999*********************************************** PP

                          HHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX.XXXX CS
                 EIN3 181 wgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss.slrk 269
                          w +lg++k qg+ppykkphdlkk wkv+vLtavikh++p++++ir+l+rqsk+lqdkm+ake+ ++l+v+nqee++++++++ s   + +
  Kalax.0730s0010.1.p 216 WCQLGFPKTQGPPPYKKPHDLKKLWKVGVLTAVIKHIAPNFTKIRKLVRQSKCLQDKMTAKETSTWLAVINQEEAIARELYPPSViACFN 305
                          ***********************************************************************************8854444 PP

                          XXXXXXXXXX.XXXXXX..........XXXXXX.XXXXXXXXXX.............XXXXXXXXXXXXXXXXXXXXX......XXXXXX CS
                 EIN3 270 qspkvtlsce.qkedve..........gkkeskikhvqavktta.............gfpvvrkrkkkpsesakvsskevsrtcqssqfr 335
                          + + +  +++  ++dv             ++s+i++  a++tt              ++++  krk+ ++ + +v  +  ++ c s q++
  Kalax.0730s0010.1.p 306 SYETFESEDDlGEYDVPlaglfddqgkNLSHSNISNLTADNTTVfgsnygtqieaptNIDFSIKRKATSEVDGSVGRS--VYICGSPQCP 393
                          44555555442466776999995543333444455555555555*************9*******9877778888766..8********* PP

                          X.XXXXXXXXXXXXXXXX CS
                 EIN3 336 gsetelifadknsisqne 353
                          + + +l+f+d+ s+++++
  Kalax.0730s0010.1.p 394 YGDIRLGFQDRASRDNHQ 411
                          ****************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.3E-12541289No hitNo description
Gene3DG3DSA:1.10.3180.106.1E-72165297IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.07E-60169292IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MGYDELDFLS GSHVEKILPA PQNESEVVLY EDSSDDDIDV DELERRMWRD KMRIKRLRER  60
QKSKEGDDGS KKQQQSEEQA RRKKMSRAQD GILKYMLKMM EVCNAQGFVY GIIPENGKPV  120
TGASDNLREW WKDRVRFDHN GPAAILKYMK DNSIPNPNGS HMLVGPTTST LQELQDTTLG  180
SLLSALMQHC DPPQRRFPLE RGVAPPWWPT GTEDWWCQLG FPKTQGPPPY KKPHDLKKLW  240
KVGVLTAVIK HIAPNFTKIR KLVRQSKCLQ DKMTAKETST WLAVINQEEA IARELYPPSV  300
IACFNSYETF ESEDDLGEYD VPLAGLFDDQ GKNLSHSNIS NLTADNTTVF GSNYGTQIEA  360
PTNIDFSIKR KATSEVDGSV GRSVYICGSP QCPYGDIRLG FQDRASRDNH QLTCSFRNSS  420
SSLKNVNYQL KPLVFNPSYI QPASVDNEVV DSRQQVIGSM MSFYDNYAQR DSGQPQRMSL  480
DQNQVQAPHL SFNNQMLIQD SSLFGNPHLP FETLPDGNNV SMIYGGAQFD IHGGTLDLIS  540
KQDPATWFQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A5e-761672992134Protein ETHYLENE INSENSITIVE 3
4zds_B5e-761672992134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003545483.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotQ9SLH00.0EIL1_ARATH; ETHYLENE INSENSITIVE 3-like 1 protein
TrEMBLA0A0R4J4Z80.0A0A0R4J4Z8_SOYBN; Uncharacterized protein
STRINGGLYMA14G04550.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27050.11e-179ETHYLENE-INSENSITIVE3-like 1